C1D (NM_173177) Human Recombinant Protein

SKU
TP303301
Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203301 protein sequence
Red=Cloning site Green=Tags(s)

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK
S

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775269
Locus ID 10438
UniProt ID Q13901
Cytogenetics 2p14
RefSeq Size 1194
RefSeq ORF 423
Synonyms hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR
Summary The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.[provided by RefSeq, Jun 2010]
Protein Families Druggable Genome
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:C1D (NM_173177) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302688 C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324) 10 ug
$3,255.00
PH303301 C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269) 10 ug
$3,255.00
LC406634 C1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416720 C1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406634 Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 2 100 ug
$436.00
LY416720 Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 1 100 ug
$436.00
TP302688 Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.