OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LSM5 (NM_012322) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303266
Recombinant protein of human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333880 Rabbit Polyclonal Anti-LSM5 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LSM5 or NM_012322"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203266 protein sequence
Red=Cloning site Green=Tags(s)

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD
QILLNGNNITMLVPGGEGPEV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036454
Locus ID 23658
UniProt ID Q9Y4Y9
Cytogenetics 7p14.3
RefSeq Size 2275
RefSeq ORF 273
Synonyms YER146W
Summary Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.supplied by OMIM, Apr 2004
Protein Categories Intracellular Proteins
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation, Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LSM5" proteins (3)
SKU Description Size Price
PH303266 LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454) 10 ug
$3,360.00
LC415800 Lyophilized LSM5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415800 Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products