OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LSM5 (NM_012322) Human Mass Spec Standard

Be the first to review this product
SKU
PH303266
LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333880 Rabbit Polyclonal Anti-LSM5 Antibody
100 ul
$585.00
LY415800 Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LSM5 or NM_012322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203266
Predicted MW 9.9 kDa
Protein Sequence
Protein Sequence
>RC203266 protein sequence
Red=Cloning site Green=Tags(s)

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD
QILLNGNNITMLVPGGEGPEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036454
RefSeq Size 2275
RefSeq ORF 273
Synonyms YER146W
Locus ID 23658
UniProt ID Q9Y4Y9
Cytogenetics 7p14.3
Summary Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.supplied by OMIM, Apr 2004
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation, Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LSM5" proteins (3)
SKU Description Size Price
LC415800 Lyophilized LSM5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415800 Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303266 Recombinant protein of human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products