OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SRP14 (NM_003134) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303212
Recombinant protein of human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA345831 Rabbit Polyclonal Anti-SRP14 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SRP14 or NM_003134"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203212 representing NM_003134
Red=Cloning site Green=Tags(s)

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003125
Locus ID 6727
UniProt ID P37108
Cytogenetics 15q15.1
RefSeq Size 800
RefSeq ORF 408
Synonyms ALURBP
Summary Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Protein export
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SRP14" proteins (3)
SKU Description Size Price
PH303212 SRP14 MS Standard C13 and N15-labeled recombinant protein (NP_003125) 10 ug
$3,360.00
LC418877 Lyophilized SRP14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418877 Transient overexpression lysate of signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products