OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SRP14 (NM_003134) Human Mass Spec Standard

Be the first to review this product
SKU
PH303212
SRP14 MS Standard C13 and N15-labeled recombinant protein (NP_003125)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345831 Rabbit Polyclonal Anti-SRP14 Antibody
100 ul
$525.00
LY418877 Transient overexpression lysate of signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) (as WB positive control) 100 ug
$436.00

Other products for "SRP14 or NM_003134"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203212
Predicted MW 14.4 kDa
Protein Sequence
Protein Sequence
>RC203212 representing NM_003134
Red=Cloning site Green=Tags(s)

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003125
RefSeq Size 800
RefSeq ORF 408
Synonyms ALURBP
Locus ID 6727
UniProt ID P37108
Cytogenetics 15q15.1
Summary Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.UniProtKB/Swiss-Prot Function
Protein Pathways Protein export
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SRP14" proteins (3)
SKU Description Size Price
LC418877 Lyophilized SRP14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418877 Transient overexpression lysate of signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) (as WB positive control) 100 ug
$436.00
TP303212 Recombinant protein of human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products