SRP14 (NM_003134) Human Tagged ORF Clone

SKU
RC203212
SRP14 (Myc-DDK-tagged)-Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SRP14
Synonyms ALURBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203212 representing NM_003134
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTTGTTGGAGAGCGAGCAGTTCCTGACGGAGCTGACCAGACTTTTCCAGAAGTGCCGGACGTCGG
GCAGCGTCTATATCACCTTGAAGAAGTATGACGGTCGAACCAAACCCATTCCAAAGAAGGGTACTGTGGA
GGGCTTTGAGCCCGCAGACAACAAGTGTCTGTTAAGAGCTACCGATGGGAAGAAGAAGATCAGCACTGTG
GTGAGCTCCAAGGAAGTGAATAAGTTTCAGATGGCTTATTCAAACCTCCTTAGAGCTAACATGGATGGGC
TGAAGAAGAGAGACAAAAAGAACAAAACTAAGAAGACCAAAGCAGCAGCAGCAGCAGCAGCAGCAGCACC
TGCCGCAGCAGCAACAGCACCAACAACAGCAGCAACAACAGCAGCAACAGCAGCACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203212 representing NM_003134
Red=Cloning site Green=Tags(s)

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003134
ORF Size 408 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003134.6
RefSeq Size 800 bp
RefSeq ORF 411 bp
Locus ID 6727
UniProt ID P37108
Cytogenetics 15q15.1
Domains SRP14
Protein Pathways Protein export
MW 14.4 kDa
Summary Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SRP14 (NM_003134) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203212L1 Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), Myc-DDK-tagged 10 ug
$525.00
RC203212L2 Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), mGFP tagged 10 ug
$525.00
RC203212L3 Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), Myc-DDK-tagged 10 ug
$525.00
RC203212L4 Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), mGFP tagged 10 ug
$525.00
RG203212 SRP14 (tGFP-tagged) - Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) 10 ug
$425.00
SC118180 SRP14 (untagged)-Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.