OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAP43 (NM_002045) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303175
Recombinant protein of human growth associated protein 43 (GAP43), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA367658 GAP43 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GAP43 or NM_002045"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203175 protein sequence
Red=Cloning site Green=Tags(s)

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE
AVDETKPKESARQDEGKEEEPEADQEHA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002036
Locus ID 2596
UniProt ID P17677
Cytogenetics 3q13.31
RefSeq Size 1747
RefSeq ORF 714
Synonyms B-50; GAP-43; PP46
Summary The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAP43" proteins (3)
SKU Description Size Price
PH303175 GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036) 10 ug
$3,360.00
LC400750 Lyophilized GAP43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400750 Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

Kinesin-1 proteins KIF5A, 5B and 5C promote anterograde transport of herpes simplex virus enveloped virions in axons
DuRaine, Wisner, Howard et al
J. Virol. (2018)
AI Summary: OriGene contributed to this study by providing human cDNAs encoding the cargo proteins GAP43, SNAP25, and APP, each fused to fluorescent tags (GFP, mRFP, or BFP), which were used to investigate the association of these cargos with HSV particles during axonal transport.
Snippet: Human cDNAs encoding the entire cargo proteins: GAP43, SNAP25, and APP all fused at the 415 N-terminus of GFP, mRFP or BFP and these were all obtained from Origene. A cDNA encoding 416 CgA fused to the N-terminus of mRFP was a gift from Dr. L. Taupenot, NIH
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products