OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB2 (NM_002575) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303139
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA503926 SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SERPINB2 or NM_002575"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203139 protein sequence
Red=Cloning site Green=Tags(s)

MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP
MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE
YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT
PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE
LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF
LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vivo treatment (intracerebral) (PMID: 30093305)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002566
Locus ID 5055
UniProt ID P05120
Cytogenetics 18q21.33-q22.1
RefSeq Size 1922
RefSeq ORF 1245
Synonyms HsT1201; PAI; PAI-2; PAI2; PLANH2
Summary Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB2" proteins (7)
SKU Description Size Price
PH303139 SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_002566) 10 ug
$3,360.00
PH327583 SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137290) 10 ug
$3,360.00
LC400915 Lyophilized SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428363 Lyophilized SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400915 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428363 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP327583 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

Post-injury Nose-to-Brain Delivery of Activin A and SerpinB2 Reduces Brain Damage in a Mouse Stroke Model
Buchthal, Weiss, Bading
Mol Ther (2018) 26 (10), 2357-2365 DOI: 10.1016/j.ymthe.2018.07.018
Cited by 42
AI Summary: In this study, OriGene’s recombinant mouse SerpinB2 protein (Cat# TP305482) was used to assess the neuroprotective effects of SerpinB2 in a mouse stroke model via nose-to-brain delivery.
Post-injury nose-to-brain delivery of Activin A and SerpinB2 reduces brain damage in a mouse stroke model
Buchthal, Weiss, Bading
Molecular Therapy (2018) 26 (10), 2357-2365 DOI: 10.1016/j.ymthe.2018.07.018
AI Summary: In this study, recombinant human SerpinB2 (amino acids 1-415, catalog number TP303139, OriGene) from OriGene was used for intracerebroventricular injection to assess its neuroprotective effects in a mouse stroke model.
Snippet: For stereotactic intracerebroventricular injection, recombinant human Activin A (amino acids 311-426, catalog cyt-569, Prospec, East Brunswick, NJ) and recombinant human SerpinB2 (amino acids 1-415, catalog TP303139, OriGene, Herford, Germany) were used;and recombinant human SerpinB2 (amino acids 1-415, catalog number TP303139, Origene, Herford) were used. For SerpinB2 (100 ng/2µl) (Origene, Herford) were infused into the left ventricle (coordinates relative to Bregma
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products