OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCCIP (NM_078468) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303061
Recombinant protein of human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308557 Rabbit polyclonal antibody to TOK-1 alpha (BRCA2 and CDKN1A interacting protein)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BCCIP or NM_078468"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203061 protein sequence
Red=Cloning site Green=Tags(s)

MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN
KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_510868
Locus ID 56647
UniProt ID Q9P287
Cytogenetics 10q26.2
RefSeq Size 1261
RefSeq ORF 942
Synonyms TOK-1; TOK1
Summary This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCCIP" proteins (7)
SKU Description Size Price
PH303061 BCCIP MS Standard C13 and N15-labeled recombinant protein (NP_510868) 10 ug
$3,360.00
LC409214 Lyophilized BCCIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409215 Lyophilized BCCIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413842 Lyophilized BCCIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409214 Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B (as WB positive control) 100 ug
$436.00
LY409215 Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant C (as WB positive control) 100 ug
$436.00
LY413842 Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant A (as WB positive control) 100 ug
$436.00

file-alt Citations

Efficient embryonic homozygous gene conversion via RAD51-enhanced interhomolog repair
Wilde, Aida, Del Rosario et al
Cell (2021) 184 (12), 3267-3280.e18 DOI: 10.1016/j.cell.2021.04.035
Cited by 95
AI Summary: In this study, OriGene's BCCIP (TP303061) and XRCC1 (TP304952) human recombinant proteins were used to investigate factors that promote interhomolog repair and enhance gene conversion efficiency in mouse embryos.
Snippet: Recombinant Human USP1&WDR48 Protein, His-tagged, Creative Biomart, USP1&WDR48-1067H. BCCIP (NM_078468) Human Recombinant Protein, Origene, TP303061. XRCC1 (NM_006297) Human Recombinant Protein, Origene, TP304952. Deposited data;BCCIP (NM_078468) Human Recombinant Protein Origene TP303061 XRCC1 (NM_006297) Human Recombinant Protein Origene TP304952
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products