OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CORO1B (NM_020441) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303023
Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501573 Anti-CORO1B (Coronin 1b) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CORO1B or NM_020441"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203023 protein sequence
Red=Cloning site Green=Tags(s)

MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR
IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW
HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL
VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS
VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM
TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065174
Locus ID 57175
UniProt ID Q9BR76
Cytogenetics 11q13.2
RefSeq Size 1927
RefSeq ORF 1467
Synonyms CORONIN-2
Summary Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 PubMed 16027158).supplied by OMIM, Mar 2008
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CORO1B" proteins (7)
SKU Description Size Price
PH303023 CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_065174) 10 ug
$3,360.00
PH322047 CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_001018080) 10 ug
$3,360.00
LC402787 Lyophilized CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422721 Lyophilized CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402787 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422721 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP322047 Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products