CORO1B (NM_001018070) Human Mass Spec Standard

SKU
PH322047
CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_001018080)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222047]
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC222047 protein sequence
Red=Cloning site Green=Tags(s)

MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR
IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW
HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL
VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS
VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM
TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018080
RefSeq Size 1949
RefSeq ORF 1467
Synonyms CORONIN-2
Locus ID 57175
UniProt ID Q9BR76
Cytogenetics 11q13.2
Summary Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CORO1B (NM_001018070) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303023 CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_065174) 10 ug
$3,255.00
LC402787 CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422721 CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402787 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 100 ug
$436.00
LY422721 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 2 100 ug
$665.00
TP303023 Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 1, 20 µg 20 ug
$737.00
TP322047 Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.