CORO1B (NM_001018070) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222047] |
Predicted MW | 54.2 kDa |
Protein Sequence |
Protein Sequence
>RC222047 protein sequence
Red=Cloning site Green=Tags(s) MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001018080 |
RefSeq Size | 1949 |
RefSeq ORF | 1467 |
Synonyms | CORONIN-2 |
Locus ID | 57175 |
UniProt ID | Q9BR76 |
Cytogenetics | 11q13.2 |
Summary | Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303023 | CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_065174) | 10 ug |
$3,255.00
|
|
LC402787 | CORO1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422721 | CORO1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402787 | Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 | 100 ug |
$436.00
|
|
LY422721 | Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 2 | 100 ug |
$665.00
|
|
TP303023 | Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP322047 | Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.