OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRAD (NM_004165) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302927
Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA314499 Rabbit polyclonal anti-RAD antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RRAD or NM_004165"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202927 representing NM_004165
Red=Cloning site Green=Tags(s)

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL
DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL
MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS
REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
FLGRIVARNSRKMAFRAKSKSCHDLSVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004156
Locus ID 6236
UniProt ID P55042
Cytogenetics 16q22.1
RefSeq Size 1443
RefSeq ORF 924
Synonyms RAD; RAD1; REM3
Summary May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRAD" proteins (7)
SKU Description Size Price
PH302927 RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156) 10 ug
$3,360.00
PH325433 RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) 10 ug
$3,360.00
LC418172 Lyophilized RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427008 Lyophilized RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418172 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427008 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325433 Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products