RRAD (NM_004165) Human Mass Spec Standard

SKU
PH302927
RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202927]
Predicted MW 33.1 kDa
Protein Sequence
Protein Sequence
>RC202927 representing NM_004165
Red=Cloning site Green=Tags(s)

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL
DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL
MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS
REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
FLGRIVARNSRKMAFRAKSKSCHDLSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004156
RefSeq Size 1443
RefSeq ORF 924
Synonyms RAD; RAD1; REM3
Locus ID 6236
UniProt ID P55042
Cytogenetics 16q22.1
Summary May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RRAD (NM_004165) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325433 RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) 10 ug
$3,255.00
LC418172 RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427008 RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418172 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 100 ug
$436.00
LY427008 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 100 ug
$436.00
TP302927 Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg 20 ug
$737.00
TP325433 Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.