OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRAD (NM_004165) Human Mass Spec Standard

Be the first to review this product
SKU
PH302927
RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314499 Rabbit polyclonal anti-RAD antibody
100 ul
$380.00
LY418172 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RRAD or NM_004165"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202927
Predicted MW 33.1 kDa
Protein Sequence
Protein Sequence
>RC202927 representing NM_004165
Red=Cloning site Green=Tags(s)

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL
DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL
MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS
REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
FLGRIVARNSRKMAFRAKSKSCHDLSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004156
RefSeq Size 1443
RefSeq ORF 924
Synonyms RAD; RAD1; REM3
Locus ID 6236
UniProt ID P55042
Cytogenetics 16q22.1
Summary May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRAD" proteins (7)
SKU Description Size Price
PH325433 RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) 10 ug
$3,360.00
LC418172 Lyophilized RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427008 Lyophilized RRAD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418172 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427008 Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302927 Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg 20 ug
$737.00
TP325433 Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products