AP2S1 (NM_004069) Human Recombinant Protein

CAT#: TP302919M

Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17, 100 µg

Product Images

Coomassie blue staining of purified AP2S1 protein (Cat# TP302919). The protein was produced from HEK293T cells transfected with AP2S1 cDNA clone (Cat# RC202919) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202919 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC
  VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS
  LE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004060
• Locus ID: 1175
• UniProt ID: P53680
• Cytogenetics: 19q13.32
• Refseq Size: 965
• Refseq ORF: 426
• Synonyms: AP17; CLAPS2; FBH3; FBHOk; HHC3
• Summary: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Pathways: Endocytosis, Huntington's disease