OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NENF (NM_013349) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302850
Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306626 Rabbit Polyclonal NENF Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NENF or NM_013349"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s)

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037481
Locus ID 29937
UniProt ID Q9UMX5
Cytogenetics 1q32.3
RefSeq Size 944
RefSeq ORF 516
Synonyms CIR2; SCIRP10; SPUF
Summary This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. provided by RefSeq, Jan 2009
Protein Categories Growth Factors, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NENF" proteins (4)
SKU Description Size Price
PH302850 NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481) 10 ug
$3,360.00
LC415653 Lyophilized NENF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415653 Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP701036 Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products