OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NENF (NM_013349) Human Mass Spec Standard

Be the first to review this product
SKU
PH302850
NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306626 Rabbit Polyclonal NENF Antibody
100 ug
$640.00
LY415653 Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NENF or NM_013349"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202850
Predicted MW 18.86 kDa
Protein Sequence
Protein Sequence
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s)

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037481
RefSeq Size 944
RefSeq ORF 516
Synonyms CIR2; SCIRP10; SPUF
Locus ID 29937
UniProt ID Q9UMX5
Cytogenetics 1q32.3
Summary This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. provided by RefSeq, Jan 2009
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NENF" proteins (4)
SKU Description Size Price
LC415653 Lyophilized NENF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415653 Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302850 Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1, 20 µg 20 ug
$867.00
TP701036 Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products