NENF (NM_013349) Human Mass Spec Standard

SKU
PH302850
NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202850]
Predicted MW 18.86 kDa
Protein Sequence
Protein Sequence
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s)

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037481
RefSeq Size 944
RefSeq ORF 516
Synonyms CIR2; SCIRP10; SPUF
Locus ID 29937
UniProt ID Q9UMX5
Cytogenetics 1q32.3
Summary This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:NENF (NM_013349) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415653 NENF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415653 Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 100 ug
$436.00
TP302850 Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701036 Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.