SH3GLB2 (NM_020145) Human Recombinant Protein

CAT#: TP302593L

Recombinant protein of human SH3-domain GRB2-like endophilin B2 (SH3GLB2), 1 mg

Product Images

Coomassie blue staining of purified SH3GLB2 protein (Cat# TP302593). The protein was produced from HEK293T cells transfected with SH3GLB2 cDNA clone (Cat# RC202593) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202593 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA
  RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISF
  LTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALW
  NDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGR
  FPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAAD
  SSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064530
• Locus ID: 56904
• UniProt ID: Q9NR46, A0A024R896
• Cytogenetics: 9q34.11
• Refseq Size: 2296
• Refseq ORF: 1185
• Synonyms: PP6569; PP9455; RRIG1
• Protein Pathways: Endocytosis