OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B14 (NM_016246) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302531
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350062 Rabbit Polyclonal Anti-HSD17B14 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HSD17B14 or NM_016246"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202531 protein sequence
Red=Cloning site Green=Tags(s)

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK
TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS
SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM
LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057330
Locus ID 51171
UniProt ID Q9BPX1
Cytogenetics 19q13.33
RefSeq Size 1277
RefSeq ORF 810
Synonyms DHRS10; retSDR3; SDR47C1
Summary 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 PubMed 17067289).supplied by OMIM, Jun 2009
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD17B14" proteins (3)
SKU Description Size Price
PH302531 HSD17B14 MS Standard C13 and N15-labeled recombinant protein (NP_057330) 10 ug
$3,360.00
LC414089 Lyophilized HSD17B14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414089 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14) (as WB positive control) 100 ug
$436.00

file-alt Citations

Discovery of the first-in-class highly potent FXR/HSD17B13 dual modulator for the treatment of metabolic dysfunction-associated steatohepatitis
Xu, Liu, Yang et al
Bioorg Chem (2026) 176, 109843 DOI: 10.1016/j.bioorg.2026.109843
AI Summary: OriGene products—recombinant HSD17B2 (TP303293), HSD17B11 (TP305941), and HSD17B14 (TP302531)—were used to assess the inhibitory effects of compounds on these enzymes, supporting the evaluation of selectivity and potency of the novel FXR/HSD17B13 dual modulator described in the study.
Snippet: The method for determining the inhibitory of compounds on HSD17B2 (Origene TP303293), HSD17B11 (Origene TP305941), and HSD17B14 (Origene TP302531) was the same as described above. But the final concentrations of recombinant
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products