HSD17B14 (NM_016246) Human Mass Spec Standard

SKU
PH302531
HSD17B14 MS Standard C13 and N15-labeled recombinant protein (NP_057330)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202531]
Predicted MW 28.3 kDa
Protein Sequence
Protein Sequence
>RC202531 protein sequence
Red=Cloning site Green=Tags(s)

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK
TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS
SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM
LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057330
RefSeq Size 1277
RefSeq ORF 810
Synonyms DHRS10; retSDR3; SDR47C1
Locus ID 51171
UniProt ID Q9BPX1
Cytogenetics 19q13.33
Summary 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HSD17B14 (NM_016246) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414089 HSD17B14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414089 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14) 100 ug
$436.00
TP302531 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.