UBE2H (NM_003344) Human Recombinant Protein

SKU TP302516

Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202516 protein sequence; Red=Cloning site Green=Tags(s); ; MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF; MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK; IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003335
• Locus ID: 7328
• UniProt ID: P62256
• Cytogenetics: 7q32.2
• RefSeq Size: 5174
• RefSeq ORF: 549
• Synonyms: E2-20K; GID3; UBC8; UBCH; UBCH2
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011]
• Protein Pathways: Ubiquitin mediated proteolysis