UBE2H (NM_003344) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202516] |
Predicted MW | 20.7 kDa |
Protein Sequence |
Protein Sequence
>RC202516 protein sequence
Red=Cloning site Green=Tags(s) MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003335 |
RefSeq Size | 5174 |
RefSeq ORF | 549 |
Synonyms | E2-20K; GID3; UBC8; UBCH; UBCH2 |
Locus ID | 7328 |
UniProt ID | P62256 |
Cytogenetics | 7q32.2 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011] |
Protein Pathways | Ubiquitin mediated proteolysis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313095 | UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_874356) | 10 ug |
$3,255.00
|
|
LC401145 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405412 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401145 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 | 100 ug |
$436.00
|
|
LY405412 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2 | 100 ug |
$436.00
|
|
TP302516 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP313095 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720162 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 | 10 ug |
$155.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.