UBE2H (NM_003344) Human Tagged ORF Clone

SKU
RC202516
UBE2H (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol UBE2H
Synonyms E2-20K; GID3; UBC8; UBCH; UBCH2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202516 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATCTCCCAGTCCGGGCAAGAGGCGGATGGACACGGACGTGGTCAAGCTCATCGAGAGTAAACATG
AGGTTACGATCCTGGGAGGACTTAATGAATTTGTAGTGAAGTTTTATGGACCACAAGGAACACCATATGA
AGGCGGAGTATGGAAAGTTAGAGTGGACCTACCTGATAAATACCCTTTCAAATCTCCATCTATAGGATTC
ATGAATAAAATTTTCCATCCCAACATTGATGAAGCGTCAGGAACTGTGTGTCTAGATGTAATTAATCAAA
CTTGGACAGCTCTCTATGATCTTACCAATATATTTGAGTCCTTCCTGCCTCAGTTATTGGCCTATCCTAA
CCCCATAGATCCTCTCAATGGTGACGCTGCAGCCATGTACCTCCACCGACCAGAAGAATACAAGCAGAAA
ATTAAAGAGTACATCCAGAAATACGCCACGGAGGAGGCGCTGAAAGAACAGGAAGAGGGTACCGGGGACA
GCTCATCGGAGAGCTCTATGTCTGACTTTTCCGAAGATGAGGCCCAGGATATGGAGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202516 protein sequence
Red=Cloning site Green=Tags(s)

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK
IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003344
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003344.4
RefSeq Size 5174 bp
RefSeq ORF 552 bp
Locus ID 7328
UniProt ID P62256
Cytogenetics 7q32.2
Domains UBCc
Protein Pathways Ubiquitin mediated proteolysis
MW 20.7 kDa
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:UBE2H (NM_003344) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202516L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202516L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202516L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202516L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202516 UBE2H (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111701 UBE2H (untagged)-Human ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.