VPS25 (NM_032353) Human Recombinant Protein

SKU TP302487

Recombinant protein of human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202487 protein sequence; Red=Cloning site Green=Tags(s); ; MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP; VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE; FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_115729
• Locus ID: 84313
• UniProt ID: Q9BRG1
• Cytogenetics: 17q21.2
• RefSeq Size: 1120
• RefSeq ORF: 528
• Synonyms: DERP9; EAP20; FAP20
• Summary: This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors
• Protein Pathways: Endocytosis