OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VPS25 (NM_032353) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302487
Recombinant protein of human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA383255 VPS25 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "VPS25 or NM_032353"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202487 protein sequence
Red=Cloning site Green=Tags(s)

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP
VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE
FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115729
Locus ID 84313
UniProt ID Q9BRG1
Cytogenetics 17q21.2
RefSeq Size 1120
RefSeq ORF 528
Synonyms DERP9; EAP20; FAP20
Summary This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1. provided by RefSeq, Jul 2013
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Transcription Factors
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VPS25" proteins (3)
SKU Description Size Price
PH302487 VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729) 10 ug
$3,360.00
LC410190 Lyophilized VPS25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410190 Transient overexpression lysate of vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products