VPS25 (NM_032353) Human Mass Spec Standard

SKU PH302487

VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202487]
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC202487 protein sequence; Red=Cloning site Green=Tags(s); ; MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP; VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE; FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_115729
• RefSeq Size: 1120
• RefSeq ORF: 528
• Synonyms: DERP9; EAP20; FAP20
• Locus ID: 84313
• UniProt ID: Q9BRG1
• Cytogenetics: 17q21.2
• Summary: This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors
• Protein Pathways: Endocytosis