UBE2D4 (NM_015983) Human Recombinant Protein

CAT#: TP302473L

Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4), 1 mg

Product Images

Coomassie blue staining of purified UBE2D4 protein (Cat# TP302473). The protein was produced from HEK293T cells transfected with UBE2D4 cDNA clone (Cat# RC202473) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202473 representing NM_015983
  Red=Cloning site Green=Tags(s)
  
  MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
  TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE
  WTQKYAM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057067
• Locus ID: 51619
• UniProt ID: Q9Y2X8, A0A024RA90
• Cytogenetics: 7p13
• Refseq Size: 1398
• Refseq ORF: 441
• Synonyms: HBUCE1
• Summary: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Ubiquitin mediated proteolysis