ACP6 (NM_016361) Human Recombinant Protein

CAT#: TP302269M

Recombinant protein of human acid phosphatase 6, lysophosphatidic (ACP6), 100 µg

Product Images

Coomassie blue staining of purified ACP6 protein (Cat# TP302269). The protein was produced from HEK293T cells transfected with ACP6 cDNA clone (Cat# RC202269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPL
  EEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLR
  KNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWS
  LRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQR
  AVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDH
  KWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQ
  VMEVGNEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057445
• Locus ID: 51205
• UniProt ID: Q9NPH0
• Cytogenetics: 1q21.2
• Refseq Size: 1832
• Refseq ORF: 1284
• Synonyms: ACPL1; LPAP; PACPL1
• Summary: This gene encodes a member of the histidine acid phosphatase protein family. The encoded protein hydrolyzes lysophosphatidic acid, which is involved in G protein-coupled receptor signaling, lipid raft modulation, and in balancing lipid composition within the cell. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Riboflavin metabolism