OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mitofusin 2 (MFN2) (NM_014874) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302218
Recombinant protein of human mitofusin 2 (MFN2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA349064 Rabbit Polyclonal Anti-MFN2 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Mitofusin 2 or NM_014874"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202218 protein sequence
Red=Cloning site Green=Tags(s)

MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVT
TEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTD
GHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELD
SWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMER
CTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS
QSAVKTKFEQHTVRAKQIAEAVRLIMDSLHMAAREQQVYCEEMREERQDRLKFIDKQLELLAQDYKLRIK
QITEEVERQVSTAMAEEIRRLSVLVDDYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSDRCSTAITNSL
QTMQQDMIDGLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPK
NSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFMVSMVTGLASLTSRTSMGILVVGGVVWKAVG
WRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLC
QQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 86.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity WB positive control (PMID: 29791782)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055689
Locus ID 9927
UniProt ID O95140
Cytogenetics 1p36.22
RefSeq Size 4685
RefSeq ORF 2271
Synonyms CMT2A; CMT2A2; CMT2A2A; CMT2A2B; CPRP1; HMSN6A; HSG; MARF
Summary This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Mitofusin 2" proteins (7)
SKU Description Size Price
PH302218 MFN2 MS Standard C13 and N15-labeled recombinant protein (NP_055689) 10 ug
$3,360.00
PH326143 MFN2 MS Standard C13 and N15-labeled recombinant protein (NP_001121132) 10 ug
$3,360.00
LC402384 Lyophilized MFN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426838 Lyophilized MFN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402384 Transient overexpression lysate of mitofusin 2 (MFN2), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426838 Transient overexpression lysate of mitofusin 2 (MFN2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP326143 Recombinant protein of human mitofusin 2 (MFN2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

Bile acids target mitofusin 2 to differentially regulate innate immunity in physiological versus cholestatic conditions
Che, Xu, Ding et al
Cell Rep (2023) 42 (1), 112011 DOI: 10.1016/j.celrep.2023.112011
Cited by 64
AI Summary: OriGene’s recombinant MFN2 protein was used in this study to analyze how bile acids influence MFN2 oligomer formation, helping to elucidate the molecular mechanisms by which bile acids regulate innate immune responses.
Snippet: For analysis of recombinant MFN2 oligomers formation, 100 ng MFN2 protein (OriGene) was incubated with indicated dose of bile acids at RT for 1 h before being boiled
Obesity leads to impairments in the morphology and organization of human skeletal muscle lipid droplets and mitochondrial networks, which are resolved with gastric bypass surgery-induced improvements in insulin sensitivity
Kristensen, Petersen, Møller et al
Acta Physiol (Oxf) (2018)
AI Summary: In this study, the recombinant human Mfn2 protein from OriGene (TP302218) was used to validate antibody specificity and assess mitofusin protein content, contributing to the analysis of mitochondrial network organization in skeletal muscle.
Snippet: Signaling Technologies). Since the anti-Mfn2 from Cell Signaling Technologies (#11925) showed equal specificity for the recombinant proteins human Mfn1 (ab132635, Abcam, Cambridge, UK) and human Mfn2 (TP302218, OriGene), it was used to assess Mfn1/2 content
Correcting mitochondrial fusion by manipulating mitofusin conformations
Franco, Kitsis, Fleischer et al
Nature (2016) 540 (7631), 74-79 DOI: 10.1038/nature20156
AI Summary: OriGene’s recombinant Mfn2 protein was used to assess how minipeptides affect Mfn2 GTPase activity, helping to elucidate mechanisms for correcting mitochondrial fusion defects.
Snippet: Minipeptide effects on Mfn2 GTPase activity were evaluated by incubating recombinant Mfn2 (100 ng, OriGene, Rockville, MD) with 1 µM control TAT peptide, TAT-367-384Gly, or TAT-398-418Gly for 15 minutes prior to addition of 0.5 mM GTP for 1 hour at 37 °C
FigureFigure
Conditional knockout of proximal tubule mitofusin 2 accelerates recovery and improves survival after renal ischemia
Gall, Wang, Bonegio et al
J Am Soc Nephrol (2015) 26 (5), 1092-102 DOI: 10.1681/ASN.2014010126
AI Summary: OriGene products contributed to this study by providing the anti-Mfn2 antibody (Cat# TA801830) and the Ras activation assay kit (Cat# STA-400), which were used to assess Mfn2 protein interactions and Ras activity, respectively.
Mfn2 Couples Glutamate Excitotoxicity and Mitochondrial Dysfunction in Motor Neurons
Wang, Zhang, Li et al
J. Biol. Chem. (2014)
AI Summary: OriGene’s recombinant Mfn2 protein was used in in vitro calpain cleavage assays to demonstrate that calpain directly degrades Mfn2, linking glutamate excitotoxicity to mitochondrial dysfunction in motor neurons.
Snippet: In vitro calpain cleavage assay 100ug purified mitochondria or 1ug recombinant Mfn2 protein (Origene, Rockville, MD) were incubated with purified human erythrocyte μ- calpain (calpain-I) (Biovision, Milpitas, CA) at 30 °C for 30 min according to manufacturer's instruction ... Cite SaveSaving
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products