OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KEAP1 (NM_203500) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302189
Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502059 KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "KEAP1 or NM_203500"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202189 protein sequence
Red=Cloning site Green=Tags(s)

MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL
RLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA
YTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMH
FGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNF
LQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDG
TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY
YPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT
VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 69.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_987096
Locus ID 9817
UniProt ID Q14145
Cytogenetics 19p13.2
RefSeq Size 2606
RefSeq ORF 1872
Synonyms INrf2; KLHL19
Summary This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Cancer: Gastrointestinal, Intracellular Proteins
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KEAP1" proteins (7)
SKU Description Size Price
PH302189 KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096) 10 ug
$3,360.00
PH302513 KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036421) 10 ug
$3,360.00
LC402183 Lyophilized KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404250 Lyophilized KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402183 Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404250 Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302513 Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

Seaweed natural products modify the host inflammatory response via Nrf2 signaling and alter colon microbiota composition and gene expression
Bousquet, Ratnayake, Pope et al
Free Radic. Biol. Med. (2019) 146, 306-323 DOI: 10.1016/j.freeradbiomed.2019.09.013
AI Summary: OriGene’s recombinant Keap1 protein (Keap1-DDK) was used to investigate how cymopol quinone modifies cysteine residues on Keap1, thereby elucidating the mechanism by which seaweed-derived compounds activate Nrf2-mediated antioxidant responses.
Snippet: Skip to article;Recombinant Keap1 protein (Keap1-DDK) (4.2 μM, Origene) dissolved in 20 mM TRIS-HCl (adjusted pH 8.0) was incubated with a solvent control (final 5% DMSO) or 1- and 10-fold excess of CymQ (5) (Experiment-1)
Characterization of RA839, a non-covalent small-molecule binder to Keap1 and selective activator of Nrf2 signalling
Winkel, Engel, Margerie et al
J. Biol. Chem. (2015)
AI Summary: OriGene’s recombinant Flag-tagged Keap1 protein was used in this study to assess the binding and inhibitory effects of the small molecule RA839 on the Keap1/Nrf2 interaction.
Snippet: 50 µl aliquots of the gel were incubated with 1 µg recombinant Flag-tagged Keap1 (OriGene) in the presence of 1 % DMSO either without RA839 or in the presence of 1 µM, 10 µM or 100 µM RA839 in a final volume of 70 µl for 5 h at room temperature. ... Cite SaveSaving
Ginger Compound [6]-Shogaol and Its Cysteine-Conjugated Metabolite (M2) Activate Nrf2 in Colon Epithelial Cells in Vitro and in Vivo
Chen, Fu, Chen et al
Chem. Res. Toxicol. (2014)
Cited by 83
AI Summary: OriGene’s human recombinant Keap1 protein (catalog no. NM_012289) was used to investigate the direct interaction and modification of Keap1 by the ginger compound [6]-shogaol in this study.
Snippet: Human recombinant Keap1 (no. NM_012289, OriGene, Rockville, MD) was incubated with 6S [molar ratios of 1:10 (Keap1/6S)] or DMSO in 120 μL of 25 mM Tris-HCl buffer (pH 8) for 2 h at room temperature
Small molecules inhibit the interaction of Nrf2 and the Keap1 Kelch domain through a non-covalent mechanism
Marcotte, Zeng, Hus et al
Bioorg. Med. Chem. (2013) 21 (14), 4011-9 DOI: 10.1016/j.bmc.2013.04.019
Cited by 242
AI Summary: OriGene’s full-length Keap1 protein with a C-terminal MycDDK tag (catalog number TP302189) was used in this study to facilitate the characterization of small molecule inhibitors targeting the Keap1-Nrf2 interaction.
Snippet: Compounds from three vendors (Maybridge, Life Chemicals, and Enamine) were docked using the Glide module (Glide version 5.5, Schrödinger, Inc ... Full-length Keap1 with a C-terminal MycDDK tag produced in HEK293T cells, was purchased from Origene (TP302189, Lot 07
Identification of UV-protective activators of nuclear factor erythroid-derived 2-related factor 2 (Nrf2) by combining a chemical library screen with computer-based virtual screening
Lieder, Reisen, Geppert et al
J. Biol. Chem. (2012) 287 (39), 33001-13 DOI: 10.1074/jbc.M112.383430
AI Summary: OriGene’s recombinant human Keap1 protein was used in this study to investigate the molecular mechanism of novel Nrf2 activators identified for UV protection.
Snippet: However, sulforaphane exerts Nrf2-independent effects, eg through direct regulation of glutathione levels (19, 20), and we recently showed that long term treatment of the skin with this compound ... Recombinant human Keap1 protein was purchased from Origene (Rockville, MD).
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products