SEC11C (NM_033280) Human Recombinant Protein

CAT#: TP302122

Recombinant protein of human SEC11 homolog C (S. cerevisiae) (SEC11C), 20 µg

Product Images

Coomassie blue staining of purified SEC11C protein (Cat# TP302122). The protein was produced from HEK293T cells transfected with SEC11C cDNA clone (Cat# RC202122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202122 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME
  PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE
  GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_150596
• Locus ID: 90701
• UniProt ID: Q9BY50
• Cytogenetics: 18q21.32
• Refseq Size: 793
• Refseq ORF: 576
• Synonyms: SEC11L3; SPC21; SPCS4C
• Summary: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Protease, Transmembrane
• Protein Pathways: Protein export