OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DRP1 (DNM1L) (NM_012063) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302046
Recombinant protein of human dynamin 1-like (DNM1L), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA506153 DNM1L mouse monoclonal antibody, clone OTI4F6 (formerly 4F6) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DRP1 or NM_012063"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202046 protein sequence
Red=Cloning site Green=Tags(s)

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV
SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV
NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRT
LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN
GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG
TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE
LAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRETKNVASGGGGVGDGVQEPTT
GNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFL
IVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQI
IAEIRETHLW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 79.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036193
Locus ID 10059
UniProt ID O00429
Cytogenetics 12p11.21
RefSeq Size 4537
RefSeq ORF 2130
Synonyms DLP1; DRP1; DVLP; DYMPLE; EMPF; EMPF1; HDYNIV; OPA5
Summary This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jun 2013
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Pathways Endocytosis, Fc gamma R-mediated phagocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DRP1" proteins (10)
SKU Description Size Price
PH302046 DNM1L MS Standard C13 and N15-labeled recombinant protein (NP_036193) 10 ug
$3,360.00
PH321708 DNM1L MS Standard C13 and N15-labeled recombinant protein (NP_036192) 10 ug
$3,360.00
LC402138 Lyophilized DNM1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416000 Lyophilized DNM1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417132 Lyophilized DNM1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402138 Transient overexpression lysate of dynamin 1-like (DNM1L), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY416000 Transient overexpression lysate of dynamin 1-like (DNM1L), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417132 Transient overexpression lysate of dynamin 1-like (DNM1L), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP321708 Recombinant protein of human dynamin 1-like (DNM1L), transcript variant 1, 20 µg 20 ug
$737.00
TP701251 Purified recombinant protein of Human dynamin 1-like (DNM1L), transcript variant 2, mutant（S590D）, 20ug 20 ug
$900.00

file-alt Citations

Protective Role of PGC-1α in Diabetic Nephropathy Is Associated with the Inhibition of ROS through Mitochondrial Dynamic Remodeling
Guo, Lu, Huang et al
PLoS ONE (2015) 10 (4), e0125176 DOI: 10.1371/journal.pone.0125176
Cited by 98
AI Summary: OriGene’s DRP1 recombinant protein was used in this study to investigate the role of mitochondrial dynamics in diabetic nephropathy, specifically examining how PGC-1α modulates DRP1-mediated mitochondrial remodeling and ROS production.
Snippet: to the manufacturer's recommendations. The incubation concentration of DRP1 recombinant protein (OriGene Technologies Inc) was 10ng/ml. Mitochondrial Morphology labeling and analysis. For morphometric analyses of mitochondria ... Cite SaveSaving
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products