ACYP2 (NM_138448) Human Recombinant Protein

CAT#: TP301976

Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg

Product Images

Coomassie blue staining of purified ACYP2 protein (Cat# TP301976). The protein was produced from HEK293T cells transfected with ACYP2 cDNA clone (Cat# RC201976) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201976 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG
  SPSSRIDRTNFSNEKTISKLEYSNFSIRY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612457
• Locus ID: 98
• UniProt ID: P14621, A0A140VJD7
• Cytogenetics: 2p16.2
• Refseq Size: 1238
• Refseq ORF: 297
• Synonyms: ACYM; ACYP
• Summary: Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
• Protein Pathways: Pyruvate metabolism