ACYP2 (NM_138448) Human Recombinant Protein
CAT#: TP301976
Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201976 protein sequence
Red=Cloning site Green=Tags(s) MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG SPSSRIDRTNFSNEKTISKLEYSNFSIRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612457 |
Locus ID | 98 |
UniProt ID | P14621, A0A140VJD7 |
Cytogenetics | 2p16.2 |
Refseq Size | 1238 |
Refseq ORF | 297 |
Synonyms | ACYM; ACYP |
Summary | Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408599 | ACYP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408599 | Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) |
USD 436.00 |
|
PH301976 | ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review