ACYP2 (NM_138448) Human Mass Spec Standard

SKU PH301976

ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201976]
• Predicted MW: 11.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC201976 protein sequence; Red=Cloning site Green=Tags(s); ; MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG; SPSSRIDRTNFSNEKTISKLEYSNFSIRY; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_612457
• RefSeq Size: 1238
• RefSeq ORF: 297
• Synonyms: ACYM; ACYP
• Locus ID: 98
• UniProt ID: P14621
• Cytogenetics: 2p16.2
• Summary: Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
• Protein Pathways: Pyruvate metabolism