ACYP2 (NM_138448) Human Mass Spec Standard

SKU
PH301976
ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201976]
Predicted MW 11.1 kDa
Protein Sequence
Protein Sequence
>RC201976 protein sequence
Red=Cloning site Green=Tags(s)

MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG
SPSSRIDRTNFSNEKTISKLEYSNFSIRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612457
RefSeq Size 1238
RefSeq ORF 297
Synonyms ACYM; ACYP
Locus ID 98
UniProt ID P14621
Cytogenetics 2p16.2
Summary Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Protein Pathways Pyruvate metabolism
Write Your Own Review
You're reviewing:ACYP2 (NM_138448) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408599 ACYP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408599 Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) 100 ug
$436.00
TP301976 Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.