ACYP2 (NM_138448) Human Recombinant Protein

SKU
TP301976
Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201976 protein sequence
Red=Cloning site Green=Tags(s)

MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG
SPSSRIDRTNFSNEKTISKLEYSNFSIRY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612457
Locus ID 98
UniProt ID P14621
Cytogenetics 2p16.2
RefSeq Size 1238
RefSeq ORF 297
Synonyms ACYM; ACYP
Summary Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Protein Pathways Pyruvate metabolism
Write Your Own Review
You're reviewing:ACYP2 (NM_138448) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301976 ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457) 10 ug
$3,255.00
LC408599 ACYP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408599 Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.