CLIC4 (NM_013943) Human Recombinant Protein

CAT#: TP301893M

Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 100 µg

Product Images

Coomassie blue staining of purified CLIC4 protein (Cat# TP301893). The protein was produced from HEK293T cells transfected with CLIC4 cDNA clone (Cat# RC201893) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201893 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA
  PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL
  ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI
  PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_039234
• Locus ID: 25932
• UniProt ID: Q9Y696, Q6FIC5
• Cytogenetics: 1p36.11
• Refseq Size: 4452
• Refseq ORF: 759
• Synonyms: CLIC4L; H1; huH1; MTCLIC; p64H1
• Summary: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other