CLIC4 (NM_013943) Human Recombinant Protein
SKU
TP301893
Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201893 protein sequence
Red=Cloning site Green=Tags(s) MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_039234 |
Locus ID | 25932 |
UniProt ID | Q9Y696 |
Cytogenetics | 1p36.11 |
RefSeq Size | 4452 |
RefSeq ORF | 759 |
Synonyms | CLIC4L; H1; huH1; MTCLIC; p64H1 |
Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301893 | CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234) | 10 ug |
$3,255.00
|
|
LC402262 | CLIC4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402262 | Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein | 100 ug |
$436.00
|
|
TP720517 | Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.