CLIC4 (NM_013943) Human Tagged ORF Clone

SKU
RC201893
CLIC4 (Myc-DDK-tagged)-Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLIC4
Synonyms CLIC4L; H1; huH1; MTCLIC; p64H1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201893 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTTGTCGATGCCGCTGAATGGGCTGAAGGAGGAGGACAAAGAGCCCCTCATCGAGCTCTTCGTCA
AGGCTGGCAGTGATGGTGAAAGCATAGGAAACTGCCCCTTTTCCCAGAGGCTCTTCATGATTCTTTGGCT
CAAAGGAGTTGTATTTAGTGTGACGACTGTTGACCTGAAAAGGAAGCCAGCAGACCTGCAGAACTTGGCT
CCCGGGACCCACCCACCATTTATAACTTTCAACAGTGAAGTCAAAACGGATGTAAATAAGATTGAGGAAT
TTCTTGAAGAAGTCTTATGCCCTCCCAAGTACTTAAAGCTTTCACCAAAACACCCAGAATCAAATACTGC
TGGAATGGACATCTTTGCCAAATTCTCTGCATATATCAAGAATTCAAGGCCAGAGGCTAATGAAGCACTG
GAGAGGGGTCTCCTGAAAACCCTGCAGAAACTGGATGAATATCTGAATTCTCCTCTCCCTGATGAAATTG
ATGAAAATAGTATGGAGGACATAAAGTTTTCTACACGTAAATTTCTGGATGGCAATGAAATGACATTAGC
TGATTGCAACCTGCTGCCCAAACTGCATATTGTCAAGGTGGTGGCCAAAAAATATCGCAACTTTGATATT
CCAAAAGAAATGACTGGCATCTGGAGATACCTAACTAATGCATACAGTAGGGACGAGTTCACCAATACCT
GTCCCAGTGATAAGGAGGTTGAAATAGCATATAGTGATGTAGCCAAAAGACTCACCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201893 protein sequence
Red=Cloning site Green=Tags(s)

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013943
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013943.3
RefSeq Size 4452 bp
RefSeq ORF 762 bp
Locus ID 25932
UniProt ID Q9Y696
Cytogenetics 1p36.11
Protein Families Druggable Genome, Ion Channels: Other
MW 28.8 kDa
Summary Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CLIC4 (NM_013943) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201893L1 Lenti ORF clone of Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC201893L2 Lenti ORF clone of Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC201893L3 Lenti ORF clone of Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC201893L4 Lenti ORF clone of Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG201893 CLIC4 (tGFP-tagged) - Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115226 CLIC4 (untagged)-Human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.