CLIC4 (NM_013943) Human Mass Spec Standard

SKU PH301893

CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201893]
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC201893 protein sequence; Red=Cloning site Green=Tags(s); ; MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA; PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL; ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI; PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_039234
• RefSeq Size: 4452
• RefSeq ORF: 759
• Synonyms: CLIC4L; H1; huH1; MTCLIC; p64H1
• Locus ID: 25932
• UniProt ID: Q9Y696
• Cytogenetics: 1p36.11
• Summary: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other