OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLIC4 (NM_013943) Human Mass Spec Standard

Be the first to review this product
SKU
PH301893
CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326231 Rabbit polyclonal CLIC4 antibody
100 ul
$380.00
LY402262 Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "CLIC4 or NM_013943"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201893
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC201893 protein sequence
Red=Cloning site Green=Tags(s)

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_039234
RefSeq Size 4452
RefSeq ORF 759
Synonyms CLIC4L; H1; huH1; MTCLIC; p64H1
Locus ID 25932
UniProt ID Q9Y696
Cytogenetics 1p36.11
Summary Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLIC4" proteins (4)
SKU Description Size Price
LC402262 Lyophilized CLIC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402262 Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP301893 Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00
TP720517 Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products