SAE1 (NM_005500) Human Recombinant Protein

CAT#: TP301820M

Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 100 µg

Product Images

Clinical features of dermatomyositis patients with anti-SAE antibodies. Specific binding of serum antibodies to recombinant SAE1 (OriGene TP301820) was analyzed using ELISA. Figure cited from Sci Rep, PMID: 28298642

• 

  Coomassie blue staining of purified SAE1 protein (Cat# TP301820). The protein was produced from HEK293T cells transfected with SAE1 cDNA clone (Cat# RC201820) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ
  VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV
  KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK
  VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL
  GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.3 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: ELISA capture for autoantibodies (PMID: 28298642)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005491
• Locus ID: 10055
• UniProt ID: Q9UBE0, A0A024R0R4
• Cytogenetics: 19q13.32
• Refseq Size: 2538
• Refseq ORF: 1038
• Synonyms: AOS1; HSPC140; SUA1; UBLE1A
• Summary: Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]
• Protein Pathways: Ubiquitin mediated proteolysis