OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Heme oxygenase 2 (HMOX2) (NM_002134) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301777
Recombinant protein of human heme oxygenase (decycling) 2 (HMOX2), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA503813 HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Heme oxygenase 2 or NM_002134"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201777 protein sequence
Red=Cloning site Green=Tags(s)

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA
TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY
IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD
LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS
SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002125
Locus ID 3163
UniProt ID P30519
Cytogenetics 16p13.3
RefSeq Size 1754
RefSeq ORF 948
Synonyms HO-2
Summary Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. provided by RefSeq, Oct 2013
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Porphyrin and chlorophyll metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Heme oxygenase 2" proteins (13)
SKU Description Size Price
PH301777 HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125) 10 ug
$3,360.00
PH325452 HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677) 10 ug
$3,360.00
PH325453 HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120678) 10 ug
$3,360.00
LC419512 Lyophilized HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426707 Lyophilized HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426708 Lyophilized HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426709 Lyophilized HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419512 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY426707 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426708 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426709 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP325452 Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 20 µg 20 ug
$867.00
TP325453 Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products