Heme oxygenase 2 (HMOX2) (NM_001127205) Human Mass Spec Standard

SKU
PH325452
HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225452]
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC225452 representing NM_001127205
Red=Cloning site Green=Tags(s)

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA
TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY
IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD
LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS
SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120677
RefSeq Size 1776
RefSeq ORF 948
Synonyms HO-2
Locus ID 3163
UniProt ID P30519
Cytogenetics 16p13.3
Summary Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
Protein Families Transmembrane
Protein Pathways Porphyrin and chlorophyll metabolism
Write Your Own Review
You're reviewing:Heme oxygenase 2 (HMOX2) (NM_001127205) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301777 HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125) 10 ug
$3,255.00
PH325453 HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120678) 10 ug
$3,255.00
LC419512 HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426707 HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426708 HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426709 HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419512 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 3 100 ug
$436.00
LY426707 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 1 100 ug
$436.00
LY426708 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 2 100 ug
$436.00
LY426709 Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 4 100 ug
$436.00
TP301777 Recombinant protein of human heme oxygenase (decycling) 2 (HMOX2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325452 Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325453 Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.