SNRPD2 (NM_004597) Human Recombinant Protein

  • Product Brand Image
SKU
TP301736
Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 20 µg
In Control Promo
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201736 protein sequence
Red=Cloning site Green=Tags(s)

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004588
Locus ID 6633
UniProt ID P62316
Cytogenetics 19q13.32
RefSeq Size 767
RefSeq ORF 354
Synonyms Sm-D2; SMD2; SNRPD1
Summary The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2009
Protein Categories Intracellular Proteins
Protein Pathways Spliceosome
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "SNRPD2" proteins (5)
SKU Description Size Price
PH301736 SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) 10 ug
$3,360.00
LC406078 SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417879 SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406078 Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2 100 ug
$436.00
LY417879 Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.