OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDT1 (NM_030928) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301657
Recombinant protein of human chromatin licensing and DNA replication factor 1 (CDT1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA367972 CDT1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CDT1 or NM_030928"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201657 representing NM_030928
Red=Cloning site Green=Tags(s)

MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRL
RLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRAL
KASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNR
SETPTFAKVQRGVQDMMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEAD
GAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQ
PPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIM
SPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112190
Locus ID 81620
UniProt ID Q9H211
Cytogenetics 16q24.3
RefSeq Size 2742
RefSeq ORF 1638
Synonyms DUP; RIS2
Summary The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. provided by RefSeq, Mar 2011
Protein Categories Intracellular Proteins
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDT1" proteins (3)
SKU Description Size Price
PH301657 CDT1 MS Standard C13 and N15-labeled recombinant protein (NP_112190) 10 ug
$3,360.00
LC403098 Lyophilized CDT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403098 Transient overexpression lysate of chromatin licensing and DNA replication factor 1 (CDT1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Distinct and sequential re-replication barriers ensure precise genome duplication
Zhou, Pozo, Oh et al
PLoS Genet (2020) 16 (8), e1008988 DOI: 10.1371/journal.pgen.1008988
Cited by 32
AI Summary: In this study, OriGene products were used to facilitate key experiments, including the use of the OriGene pCMV6-Entry-Cdt1 expression plasmid to express Cdt1 and OriGene Cdt1 shRNA constructs for Cdt1 knockdown, enabling the authors to dissect the role of Cdt1 phosphorylation in preventing DNA re-replication.
FigureFigureFigure
Distinct and sequential re-replication barriers ensure precise genome duplication
Zhou, Pozo, Oh et al
bioRxiv (2020)
Snippet: … Cached;200 ng of recombinant human Cdt1 (OriGene, Cat #: TP301657) and 20 ng of purified 566 Cyclin A/Cdk1 (Sigma cat. #CO244, lot SLBW3287) were incubated in kinase buffer (50 567 mM Tris pH 7.5, 10 mM MgCl2) supplemented with protease inhibitors (0.1 mM AEBSF, 568 10 µg/mL pepstatin A, 10 µg/mL leupeptin, 10 µg/mL aprotinin), phosphatase inhibitors 569 (5 µg/mL phosvitin, 1 mM β-glycerol phosphate, 1 mM Na-orthovanadate), 10 µM ATP, 2
Cdt1 stabilizes kinetochore-microtubule attachments via an Aurora B kinase-dependent mechanism
Agarwal, Smith, Zhou et al
J. Cell Biol. (2018)
AI Summary: OriGene’s purified C-terminal Myc/DDK-tagged Cdt1 protein (catalog number TP301657) was used in this study to investigate the direct binding of Cdt1 to microtubules and its role in stabilizing kinetochore-microtubule attachments.
Snippet: Page 1. ARTICLE https://doi.org/10.1083/jcb.201705127 1 J. Cell Biol. 2018 Rockefeller University Press Robust kinetochore-microtubule (kMT) attachment is critical for accurate chromosome segregation. G2/M-specific depletion;purified from HEK293 cells with a C-terminal Myc/DDK tag dialyzed in 25 mM Tris-HCl, pH 7.3, 100 mM glycine, and 10% glycerol was purchased from Origene (TP301657)
Human replication licensing factor Cdt1 directly links mitotic kinetochores to spindle microtubules
Agarwal, Smith, Zhou et al
bioRxiv (2017)
Snippet: Full - length human Cdt1 (1 - 546 aa) purified from HEK293 cells with a C - terminal Myc/DDK tag dialyzed in 25 mM Tris - HCl, pH 7. 3, 100 mM glycine and 10% glycerol was purchased from Origene ( TP301657 )
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products