OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CYB5R3 (NM_000398) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301592
Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501353 CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CYB5R3 or NM_000398"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201592 protein sequence
Red=Cloning site Green=Tags(s)

MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHI
LGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTI
EFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFAN
QTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMI
QYACLPNLDHVGHPTERCFVF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000389
Locus ID 1727
UniProt ID P00387
Cytogenetics 22q13.2
RefSeq Size 2923
RefSeq ORF 903
Synonyms B5R; DIA1
Summary This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. provided by RefSeq, Jan 2010
Protein Categories Cardiovascular diseases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CYB5R3" proteins (10)
SKU Description Size Price
PH301592 CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_000389) 10 ug
$3,360.00
PH317552 CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_015565) 10 ug
$3,360.00
LC400140 Lyophilized CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416053 Lyophilized CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432902 Lyophilized CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400140 Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY416053 Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432902 Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP317552 Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2, 20 µg 20 ug
$737.00
TP329902 Purified recombinant protein of Homo sapiens cytochrome b5 reductase 3 (CYB5R3), transcript variant 5, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products