CYB5R3 (NM_001171660) Human Recombinant Protein
SKU
TP329902
Purified recombinant protein of Homo sapiens cytochrome b5 reductase 3 (CYB5R3), transcript variant 5, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC229902 representing NM_001171660
Red=Cloning site Green=Tags(s) MNRSLLVGCMQSKDIWGREESICERLKQDGLDVERAESWELGHMVLFPVWFLYSLLMKLFQRSTPAITLE SPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVD LVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGM IAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWD YGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001165131 |
Locus ID | 1727 |
UniProt ID | P00387 |
Cytogenetics | 22q13.2 |
RefSeq ORF | 1002 |
Synonyms | B5R; DIA1 |
Summary | This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301592 | CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_000389) | 10 ug |
$3,255.00
|
|
PH317552 | CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_015565) | 10 ug |
$3,255.00
|
|
LC400140 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416053 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432902 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400140 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 1 | 100 ug |
$436.00
|
|
LY416053 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 | 100 ug |
$436.00
|
|
LY432902 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 5 | 100 ug |
$436.00
|
|
TP301592 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP317552 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.