OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Vimentin (VIM) (NM_003380) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301546M
Recombinant protein of human vimentin (VIM), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA801297 VIM mouse monoclonal antibody, clone OTI1A9 (formerly 1A9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Vimentin or NM_003380"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201546 representing NM_003380
Red=Cloning site Green=Tags(s)

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003371
Locus ID 7431
UniProt ID P08670
Cytogenetics 10p13
RefSeq Size 1847
RefSeq ORF 1398
Summary This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. provided by RefSeq, Aug 2017
Protein Categories ADC Targets, Intracellular Proteins, Nervous system Diseases
Protein Families ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A Binding Potency Assay for Pritumumab and Ecto-Domain Vimentin
Babic, Kesari, Glassy
Methods Mol. Biol. (2019) 1904, 401-415 DOI: 10.1007/978-1-4939-8958-4_19
Snippet: This requires testing different sources of human vimentin, testing different concentrations, and testing capture time. As an example, Fig. 1 shows an initial test of two sources of human vimentin: one from Sino Biological and one from Origene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products