OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FZR1 (NM_016263) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301413
Recombinant protein of human fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA339173 Rabbit Polyclonal Anti-FZR1
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FZR1 or NM_016263"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201413 protein sequence
Red=Cloning site Green=Tags(s)

MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS
PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD
DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY
LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN
AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ
YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFT
RIR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 54.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057347
Locus ID 51343
UniProt ID Q9UM11
Cytogenetics 19p13.3
RefSeq Size 3615
RefSeq ORF 1479
Synonyms CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1
Summary Substrate-specific adapter for the anaphase promoting complex/cyclosome (APC/C) E3 ubiquitin-protein ligase complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis. Acts as an adapter for APC/C to target the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. Through the regulation of RBBP8/CtIP protein turnover, may play a role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR) (PubMed:25349192).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FZR1" proteins (7)
SKU Description Size Price
PH301413 FZR1 MS Standard C13 and N15-labeled recombinant protein (NP_057347) 10 ug
$3,360.00
LC402526 Lyophilized FZR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427845 Lyophilized FZR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427846 Lyophilized FZR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402526 Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427845 Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427846 Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products