SFXN2 (NM_178858) Human Recombinant Protein

CAT#: TP301408

Recombinant protein of human sideroflexin 2 (SFXN2), 20 µg

Product Images

Coomassie blue staining of purified SFXN2 protein (Cat# TP301408). The protein was produced from HEK293T cells transfected with SFXN2 cDNA clone (Cat# RC201408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201408 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYA
  KKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGFMLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASP
  TSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLVGRWVPFAAVAAANCVNIPMMRQQELIKGICVKDRN
  ENEIGHSRRAAAIGITQVVISRITMSAPGMILLPVIMERLEKLHFMQKVKVLHAPLQVMLSGCFLIFMVP
  VACGLFPQKCELPVSYLEPKLQDTIKAKYGELEPYVYFNKGL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_849189
• Locus ID: 118980
• UniProt ID: Q96NB2
• Cytogenetics: 10q24.32
• Refseq Size: 2562
• Refseq ORF: 966
• Synonyms: SLC56A2
• Summary: Mitochondrial amino-acid transporter that mediates transport of serine into mitochondria.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane