TRAPPC6A (NM_024108) Human Recombinant Protein

SKU TP301311

Recombinant protein of human trafficking protein particle complex 6A (TRAPPC6A), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201311 protein sequence; Red=Cloning site Green=Tags(s); ; MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET; LAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGL; LRGALYTLGIESVVTASVAALPVCKFQVVIPKS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_077013
• Locus ID: 79090
• UniProt ID: O75865
• Cytogenetics: 19q13.32
• RefSeq Size: 838
• RefSeq ORF: 519
• Synonyms: TRS33
• Summary: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]