OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAL (NM_002371) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301256
Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MAL or NM_002371"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201256 protein sequence
Red=Cloning site Green=Tags(s)

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI
ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV
VHAVFSLIRWKSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002362
Locus ID 4118
UniProt ID P21145
Cytogenetics 2q11.1
RefSeq Size 1153
RefSeq ORF 459
Synonyms MVP17; VIP17
Summary The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. provided by RefSeq, May 2012
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAL" proteins (11)
SKU Description Size Price
PH301256 MAL MS Standard C13 and N15-labeled recombinant protein (NP_002362) 10 ug
$3,360.00
PH311612 MAL MS Standard C13 and N15-labeled recombinant protein (NP_071885) 10 ug
$3,360.00
PH317248 MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883) 10 ug
$3,360.00
LC400850 Lyophilized MAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411702 Lyophilized MAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411704 Lyophilized MAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400850 Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant a (as WB positive control) 100 ug
$436.00
LY411702 Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant b (as WB positive control) 100 ug
$436.00
LY411704 Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant d (as WB positive control) 100 ug
$436.00
TP311612 Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant d, 20 µg 20 ug
$737.00
TP317248 Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant b, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products