CD20 (MS4A1) (NM_021950) Human Recombinant Protein

CAT#: TP301242

Reviews ()
Write a review

Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3



  View other "MS4A1" proteins (6)

Special Offer: 30% off on this product. Use code "Pro30".

USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201242 protein sequence
Red=Cloning site Green=Tags(s)

MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL
MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG
IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP
EPPQDQESSPIENDSSP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_068769
Locus ID 931
UniProt ID P11836, A0A024R507
Cytogenetics 11q12.2
Refseq Size 3331
Refseq ORF 891
Synonyms B1; Bp35; CD20; CVID5; FMC7; LEU-16; MS4A2; S7
Summary This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage

Documents

Other Versions

Other products for "MS4A1"
Frequently bought together (2)
MS4A1 (CD20) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
    • 100 ul

USD 417.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.